EYA4 Peptide - middle region
EYA4 Peptide - middle region
Product Specifications
Product Name Alternative
CMD1J, DFNA10
UniProt
O95677
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EYA4 Rabbit Polyclonal Antibody (orb589873) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_004091.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKSRGRGRKNNPSP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC208908L2V 200 µL
GRAP (NM_006613) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
039599-ML490 100 µL
PABPC1L2B, CT (PABPC1L2A, PABPC1L2, RBM32A, Polyadenylate-binding protein 1-like 2, RNA-binding motif protein 32, RNA-binding protein 32) (MaxLight 490) discontinued
Sign In for Pricing
View Details