Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AEN Peptide - N-terminal region

AEN Peptide - N-terminal region

Product Specifications

Product Name Alternative

ISG20L1, pp12744

UniProt

Q8WTP8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AEN Rabbit Polyclonal Antibody (orb589877) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_073604.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: REAPESAQCLCPSLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Thrombospondin 1 Monoclonal Antibody
E-AB-81612-01 50 µL

Recombinant Thrombospondin 1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Thrombospondin 1 Monoclonal Antibody
E-AB-81612-02 100 µL

Recombinant Thrombospondin 1 Monoclonal Antibody

Sign In for Pricing
View Details
2-Sulfobenzoic Anhydride
TRC-S689188-5G 5 g

2-Sulfobenzoic Anhydride

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (rCR2/1952), CF647 conjugate, 0.1mg/mL
BNC473789-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (rCR2/1952), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dibenzo[def,p]chrysene-d8 (Major)
TRC-D416947-1MG 1 mg

Dibenzo[def,p]chrysene-d8 (Major)

Sign In for Pricing
View Details
Dimenhydrinate
TRC-D460520-5G 5 g

Dimenhydrinate

Sign In for Pricing
View Details