Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AEN Peptide - N-terminal region

AEN Peptide - N-terminal region

Product Specifications

Product Name Alternative

ISG20L1, pp12744

UniProt

Q8WTP8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AEN Rabbit Polyclonal Antibody (orb589877) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_073604.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: REAPESAQCLCPSLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il6 Mouse Gene Knockout Kit (CRISPR)
KN308293BN 1 Kit

Il6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
USP28 Mouse Monoclonal Antibody [A1F9]
EM1901-46 100 µL

USP28 Mouse Monoclonal Antibody [A1F9]

Sign In for Pricing
View Details
Human Glutathione S Transferase Theta 1 (GSTt1) ELISA Kit
RD-GSTt1-Hu-01 96 Tests

Human Glutathione S Transferase Theta 1 (GSTt1) ELISA Kit

Sign In for Pricing
View Details
Human Glutathione S Transferase Theta 1 (GSTt1) ELISA Kit
RD-GSTt1-Hu-02 48 Tests

Human Glutathione S Transferase Theta 1 (GSTt1) ELISA Kit

Sign In for Pricing
View Details
Cig2 (3A11/5), 0.2mg/mL
BNUB2827-100 1x 100 µL

Cig2 (3A11/5), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712134 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details