Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIDINS220 Peptide - middle region

KIDINS220 Peptide - middle region

Product Specifications

Product Name Alternative

ARMS

UniProt

Q9ULH0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIDINS220 Rabbit Polyclonal Antibody (orb589878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065789.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPGSTTISGRSSPHSTYYMGQSSSGGSIHSNLEQEKGKDSEPKPDDGRKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT40
321955-01 50 µL

KRT40

Sign In for Pricing
View Details
KRT40
321955-02 100 µL

KRT40

Sign In for Pricing
View Details
HES7 Human qPCR Primer Pair (NM_032580)
HP216044 200 Reactions

HES7 Human qPCR Primer Pair (NM_032580)

Sign In for Pricing
View Details
CDK2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0416904 1.0 µg DNA

CDK2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-Ferritin FTH1 Rabbit Monoclonal Antibody
M02401 100 µL/Vial

Anti-Ferritin FTH1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
RELT Polyclonal Antibody, Biotin Conjugated
A52197-100 100 µL

RELT Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details