Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIDINS220 Peptide - middle region

KIDINS220 Peptide - middle region

Product Specifications

Product Name Alternative

ARMS

UniProt

Q9ULH0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIDINS220 Rabbit Polyclonal Antibody (orb589878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065789.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPGSTTISGRSSPHSTYYMGQSSSGGSIHSNLEQEKGKDSEPKPDDGRKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FANCG Protein, N-His
orb2821107-01 20 µg

Recombinant Human FANCG Protein, N-His

Sign In for Pricing
View Details
Recombinant Human FANCG Protein, N-His
orb2821107-02 50 µg

Recombinant Human FANCG Protein, N-His

Sign In for Pricing
View Details
Recombinant Human FANCG Protein, N-His
orb2821107-03 100 µg

Recombinant Human FANCG Protein, N-His

Sign In for Pricing
View Details
L-Ascorbic Acid 3-Sulfate
TRC-A787025-100MG 100 mg

L-Ascorbic Acid 3-Sulfate

Sign In for Pricing
View Details
ILF2 Human shRNA Lentiviral Particle (Locus ID 3608)
TL312155V 500 µL Each

ILF2 Human shRNA Lentiviral Particle (Locus ID 3608)

Sign In for Pricing
View Details
VDR agonist 1
HY-114310 1 Each

VDR agonist 1

Sign In for Pricing
View Details