Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP110 Peptide - middle region

SP110 Peptide - middle region

Product Specifications

Product Name Alternative

IPR1, VODI, IFI41, IFI75

UniProt

Q9HB58

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SP110 Rabbit Polyclonal Antibody (orb589880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001171944.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPEEPQEVSSTPSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL4L1 (C-C Motif Chemokine 4-like, Small-inducible Cytokine A4-like, Monocyte Adherence-induced Protein 5-alpha, Macrophage Inflammatory Protein 1-beta, MIP-1-beta, Lymphocyte Activation Gene 1 Protein, LAG-1, CCL4L, LAG1, SCYA4L1, CCL4L2, CCL4L, SCYA4L2) (MaxLight 750) discontinued
124469-ML750 100 µL

CCL4L1 (C-C Motif Chemokine 4-like, Small-inducible Cytokine A4-like, Monocyte Adherence-induced Protein 5-alpha, Macrophage Inflammatory Protein 1-beta, MIP-1-beta, Lymphocyte Activation Gene 1 Protein, LAG-1, CCL4L, LAG1, SCYA4L1, CCL4L2, CCL4L, SCYA4L2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
1-Phenyl-3- (thiophen-2-yl) -1H-pyrazole-4-carbaldehyde
OR1042440-01 100 mg

1-Phenyl-3- (thiophen-2-yl) -1H-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details
1-Phenyl-3- (thiophen-2-yl) -1H-pyrazole-4-carbaldehyde
OR1042440-02 250 mg

1-Phenyl-3- (thiophen-2-yl) -1H-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details
1-Phenyl-3- (thiophen-2-yl) -1H-pyrazole-4-carbaldehyde
OR1042440-03 500 mg

1-Phenyl-3- (thiophen-2-yl) -1H-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details
1-Phenyl-3- (thiophen-2-yl) -1H-pyrazole-4-carbaldehyde
OR1042440-04 1 g

1-Phenyl-3- (thiophen-2-yl) -1H-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details
1-Phenyl-3- (thiophen-2-yl) -1H-pyrazole-4-carbaldehyde
OR1042440-05 5 g

1-Phenyl-3- (thiophen-2-yl) -1H-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details