Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP110 Peptide - middle region

SP110 Peptide - middle region

Product Specifications

Product Name Alternative

IPR1, VODI, IFI41, IFI75

UniProt

Q9HB58

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SP110 Rabbit Polyclonal Antibody (orb589880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001171944.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPEEPQEVSSTPSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal gp96/HSP90B1/GRP94 Antibody (2H3) [DyLight 755]
NBP1-04346IR 0.1 mL

Mouse Monoclonal gp96/HSP90B1/GRP94 Antibody (2H3) [DyLight 755]

Sign In for Pricing
View Details
Atp9a Mouse Gene Knockout Kit (CRISPR)
KN501838 1 Kit

Atp9a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dmrtc1c1 Protein Vector (Mouse) (pPM-C-His)
PV172501 500 ng

Dmrtc1c1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
DHEA Sulphate (DHEA-S, Dehydroepiandrosterone Sulphate) (MaxLight 550) discontinued
226918-ML550 100 µL

DHEA Sulphate (DHEA-S, Dehydroepiandrosterone Sulphate) (MaxLight 550) discontinued

Sign In for Pricing
View Details
TPM4 (Tropomyosin alpha-4 Chain, TM30p1, Tropomyosin-4, TPM4)
407230-01 50 µL

TPM4 (Tropomyosin alpha-4 Chain, TM30p1, Tropomyosin-4, TPM4)

Sign In for Pricing
View Details
TPM4 (Tropomyosin alpha-4 Chain, TM30p1, Tropomyosin-4, TPM4)
407230-02 100 µL

TPM4 (Tropomyosin alpha-4 Chain, TM30p1, Tropomyosin-4, TPM4)

Sign In for Pricing
View Details