Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UFD1 Peptide - middle region

UFD1 Peptide - middle region

Product Specifications

Product Name Alternative

UFD1L

UniProt

Q92890

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UFD1 Rabbit Polyclonal Antibody (orb589882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005650.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC anti-human CD158b (KIR2DL2/L3, NKAT2)
E16FHF158b-025 25 Tests

FITC anti-human CD158b (KIR2DL2/L3, NKAT2)

Sign In for Pricing
View Details
ADAR Protein Vector (Human) (pPM-C-HA)
11377021 500 ng

ADAR Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PTMAP7 Protein Vector (Human) (pPM-C-His)
PV114173 500 ng

PTMAP7 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-Ms CD54 Purified Low Endotoxin
12-625-C100 0.1 mg

Anti-Ms CD54 Purified Low Endotoxin

Sign In for Pricing
View Details
SensiMix MicroRNA Primer Panels
HPP3001B 1 Each

SensiMix MicroRNA Primer Panels

Sign In for Pricing
View Details
GPR-39 (423-453) (Human) - FITC Labeled Purified IgG
FG-G-002-85B 100 µL

GPR-39 (423-453) (Human) - FITC Labeled Purified IgG

Sign In for Pricing
View Details