UFD1 Peptide - middle region
UFD1 Peptide - middle region
Product Specifications
Product Name Alternative
UFD1L
UniProt
Q92890
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UFD1 Rabbit Polyclonal Antibody (orb589882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005650.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6354856-01 0.2 mL
TESK1, ID (TESK1, Dual specificity testis-specific protein kinase 1, Testicular protein kinase 1) (Biotin)
Sign In for Pricing
View Details MBS6354856-02 5x 0.2 mL
TESK1, ID (TESK1, Dual specificity testis-specific protein kinase 1, Testicular protein kinase 1) (Biotin)
Sign In for Pricing
View Details MBS269322-01 48 Well
Rat Macrophage Inflammatory Protein 5 (MIP-5) ELISA Kit
Sign In for Pricing
View Details