UFD1 Peptide - middle region
UFD1 Peptide - middle region
Product Specifications
Product Name Alternative
UFD1L
UniProt
Q92890
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UFD1 Rabbit Polyclonal Antibody (orb589882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005650.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP34310_P050 100 µL
SERTAD1 antibody - N-terminal region (ARP34310_P050)
Sign In for Pricing
View Details orb1947020-01 48 Tests
Mouse Epithelial Cell Adhesion Molecule (EPCAM) ELISA Kit
Sign In for Pricing
View Details orb1947020-02 96 Tests
Mouse Epithelial Cell Adhesion Molecule (EPCAM) ELISA Kit
Sign In for Pricing
View Details A06705-2-carrier-free 100 µg/Vial
Anti-RAD51AP1 Antibody Picoband®, Carrier-free
Sign In for Pricing
View Details IBCTAPOA1RNHISLY100UG 100 µg
Bacteria-Derived Apolipoprotein A-I Recombinant Protein N-His Tag Lyophilized 100ug
Sign In for Pricing
View Details 
TA363829 100 µg
Kappa light chain, mouse anti human, clone κ -117 Biotin
Sign In for Pricing
View Details