UFD1 Peptide - middle region
UFD1 Peptide - middle region
Product Specifications
Product Name Alternative
UFD1L
UniProt
Q92890
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UFD1 Rabbit Polyclonal Antibody (orb589882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005650.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal CDKL2 Antibody (OTI12C2) [DyLight 350]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP2-71406UV 0.1 mL
Mouse Monoclonal CDKL2 Antibody (OTI12C2) [DyLight 350]
Sign In for Pricing
View Details R14293m 1 Each
Mouse Ywhaq / 14-3-3 protein theta Recombinant Protein
Sign In for Pricing
View Details MBS1014821-01 0.02 mg (E-Coli)
Recombinant Salmonella typhimurium Regulatory protein pocR (pocR)
Sign In for Pricing
View Details MBS1014821-02 0.02 mg (Yeast)
Recombinant Salmonella typhimurium Regulatory protein pocR (pocR)
Sign In for Pricing
View Details MBS1014821-03 0.1 mg (E-Coli)
Recombinant Salmonella typhimurium Regulatory protein pocR (pocR)
Sign In for Pricing
View Details MBS1014821-04 0.1 mg (Yeast)
Recombinant Salmonella typhimurium Regulatory protein pocR (pocR)
Sign In for Pricing
View Details