Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UFD1 Peptide - middle region

UFD1 Peptide - middle region

Product Specifications

Product Name Alternative

UFD1L

UniProt

Q92890

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UFD1 Rabbit Polyclonal Antibody (orb589882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005650.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Glutamyl Aminopeptidase (Aminopeptidase A) (ENPEP) ELISA Kit
abx357687 96 Well

Guinea pig Glutamyl Aminopeptidase (Aminopeptidase A) (ENPEP) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2)
MBS2122881-01 0.01 mg

Recombinant Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2)

Sign In for Pricing
View Details
Recombinant Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2)
MBS2122881-02 0.05 mg

Recombinant Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2)

Sign In for Pricing
View Details
Recombinant Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2)
MBS2122881-03 0.1 mg

Recombinant Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2)

Sign In for Pricing
View Details
Recombinant Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2)
MBS2122881-04 0.2 mg

Recombinant Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2)

Sign In for Pricing
View Details
Recombinant Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2)
MBS2122881-05 0.5 mg

Recombinant Rho Associated Coiled Coil Containing Protein Kinase 2 (Rock2)

Sign In for Pricing
View Details