SETD1A Peptide - middle region
SETD1A Peptide - middle region
Product Specifications
Product Name Alternative
Set1, KMT2F, Set1A
UniProt
O15047
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SETD1A Rabbit Polyclonal Antibody (orb589884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055527.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RRRSLRSHARRRRPPPPPPPPPPRAYEPRSEFEQMTILYDIWNSGLDSED
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
F4510-91-AP 100 µL
FBLIM1 (FBLP1, Filamin-binding LIM Protein 1, Migfilin, Mitogen-inducible 2-interacting Protein, MIG2-interacting Protein, CAL, DKFZp434G171, FBLP-1, RP11-169K16.5) (AP) discontinued
Sign In for Pricing
View Details LV650133 1.0 µg DNA
CILP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details 
DZ41514-FITC 200 µL/Vial
Anti-Fruit fly Marf Antibody-FITC Conjugate
Sign In for Pricing
View Details 