Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETD1A Peptide - middle region

SETD1A Peptide - middle region

Product Specifications

Product Name Alternative

Set1, KMT2F, Set1A

UniProt

O15047

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SETD1A Rabbit Polyclonal Antibody (orb589884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055527.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRRSLRSHARRRRPPPPPPPPPPRAYEPRSEFEQMTILYDIWNSGLDSED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMMR siRNA (Human)
orb1866101-01 15 nmol

HMMR siRNA (Human)

Sign In for Pricing
View Details
HMMR siRNA (Human)
orb1866101-02 30 nmol

HMMR siRNA (Human)

Sign In for Pricing
View Details
ONECUT1 Polyclonal Conjugated Antibody
C31729 100 µL

ONECUT1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Anti-PRKCE Antibody Picoband®, iFluor647 Conjugate
A01151-1-iFluor647 100 µg

Anti-PRKCE Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Alox15 3'UTR GFP Stable Cell Line
TU250545 1.0 mL

Alox15 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-GATA1 Antibody Picoband®, Dylight594 Conjugate
A00408-3-Dylight594 100 µg

Anti-GATA1 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details