Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A33 Peptide - C-terminal region

SLC25A33 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PNC1, BMSC-MCP

UniProt

Q9BSK2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A33 Rabbit Polyclonal Antibody (orb584704) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_115691

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU1P1 CRISPRa sgRNA lentivector (set of three targets)(Human)
67002121 3x 1.0µg DNA

RNU1P1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Bovine Hepcidin Antimicrobial Peptide ELISA Kit
OM619964 96 Strip Well

Bovine Hepcidin Antimicrobial Peptide ELISA Kit

Sign In for Pricing
View Details
Anti-DPP2 Antibody (1H819)
TMAY-01119-01 20 µL

Anti-DPP2 Antibody (1H819)

Sign In for Pricing
View Details
Anti-DPP2 Antibody (1H819)
TMAY-01119-02 100 µL

Anti-DPP2 Antibody (1H819)

Sign In for Pricing
View Details
Sirtuin 7 (SIRT7) Magnetic Luminex Assay Kit
LKU601210 96 Tests

Sirtuin 7 (SIRT7) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Granzymes A (Gzms-A) Human ELISA Kit
D8330 96 Tests

Granzymes A (Gzms-A) Human ELISA Kit

Sign In for Pricing
View Details