Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPDL Peptide - middle region

HPDL Peptide - middle region

Product Specifications

Product Name Alternative

GLOXD1, 4-HPPD-L

UniProt

Q96IR7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPDL Rabbit Polyclonal Antibody (orb584750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_116145

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEMTAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat PCSK9 Antibody Pair Set
E-KAB-0109 50 µL & 100 µg

Rat PCSK9 Antibody Pair Set

Sign In for Pricing
View Details
Zfp536 Mouse Gene Knockout Kit (CRISPR)
KN519874 1 Kit

Zfp536 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PVRL4 Antibody
8C17761-AAT 50 µg

PVRL4 Antibody

Sign In for Pricing
View Details
ANKRD40 Human qPCR Primer Pair (NM_052855)
HP216487 200 Reactions

ANKRD40 Human qPCR Primer Pair (NM_052855)

Sign In for Pricing
View Details
Dl-glutamic acid monohydrate
TRC-G597110-500MG 500 mg

Dl-glutamic acid monohydrate

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS801120 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details