Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPDL Peptide - middle region

HPDL Peptide - middle region

Product Specifications

Product Name Alternative

GLOXD1, 4-HPPD-L

UniProt

Q96IR7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPDL Rabbit Polyclonal Antibody (orb584750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_116145

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEMTAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH6A1 Rabbit Polyclonal Antibody
TA373447 100 µL

ALDH6A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CAMK2A (+CAMK2D) Rabbit Polyclonal Antibody
AP20564PU-N 100 µg

CAMK2A (+CAMK2D) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chitobiose Octaacetate
TRC-C315000-50MG 50 mg

Chitobiose Octaacetate

Sign In for Pricing
View Details
PPP2R2A (NM_002717) Human Over-expression Lysate
LY400958 100 µg

PPP2R2A (NM_002717) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Pur B (PURB) activation kit by CRISPRa
GA103953 1 Kit

Human Pur B (PURB) activation kit by CRISPRa

Sign In for Pricing
View Details
1,10-Dibromo-2,9-decanedione
TRC-D822480-1G 1 g

1,10-Dibromo-2,9-decanedione

Sign In for Pricing
View Details