Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED18 Peptide - C-terminal region

MED18 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P28b

UniProt

Q9BUE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED18 Rabbit Polyclonal Antibody (orb585232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060108

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMKNFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QKI Recombinant Mouse monoclonal Antibody
HA610222 100 µg

QKI Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Tph2 Mouse Gene Knockout Kit (CRISPR)
KN518088 1 Kit

Tph2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDPN Rabbit Polyclonal Antibody
TA384955 100 µL

PDPN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (121-3), CF405S conjugate, 0.1mg/mL
BNC040945-100 1x 100 µL

Double Stranded DNA (dsDNA) (121-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse IL-35 (Interleukin 35) ELISA Kit
E-EL-M0733-01 24 Tests

Mouse IL-35 (Interleukin 35) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-35 (Interleukin 35) ELISA Kit
E-EL-M0733-02 48 Tests

Mouse IL-35 (Interleukin 35) ELISA Kit

Sign In for Pricing
View Details