MED18 Peptide - C-terminal region
MED18 Peptide - C-terminal region
Product Specifications
Product Name Alternative
P28b
UniProt
Q9BUE0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MED18 Rabbit Polyclonal Antibody (orb585232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_060108
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MKIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMKNFA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN200700LP 1 Kit
PmL Protein (PmL) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
![p38 alpha/MAPK14 + p38 beta/MAPK11 + p38 gamma/MAPK12 Recombinant Rabbit Monoclonal Antibody [PSH03-60]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81ff2/imageurl/ha722019.webp)
HA722019 100 µL
p38 alpha/MAPK14 + p38 beta/MAPK11 + p38 gamma/MAPK12 Recombinant Rabbit Monoclonal Antibody [PSH03-60]
Sign In for Pricing
View Details 