Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOST Peptide - C-terminal region

SOST Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDD, VBCH, DAND6, SOST1

UniProt

Q9BQB4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOST Rabbit Polyclonal Antibody (orb585686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_079513

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2138828-01 0.1 mL

Monoclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details
Monoclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2138828-02 0.2 mL

Monoclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details
Monoclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2138828-03 0.5 mL

Monoclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details
Monoclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2138828-04 1 mL

Monoclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details
Monoclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2138828-05 5 mL

Monoclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details
Monoclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2138828-06 5x 5 mL

Monoclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details