Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC2A3 Peptide - middle region

SLC2A3 Peptide - middle region

Product Specifications

Product Name Alternative

GLUT3

UniProt

Q8TDB8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC2A3 Rabbit Polyclonal Antibody (orb588170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_008862

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Aminobenzamide
abx183079-01 100 g

2-Aminobenzamide

Sign In for Pricing
View Details
2-Aminobenzamide
abx183079-02 500 g

2-Aminobenzamide

Sign In for Pricing
View Details
Human Semaphorin 3A Alexa Fluor 488 MAb (Clone 215803)
IC1250G 100 Tests

Human Semaphorin 3A Alexa Fluor 488 MAb (Clone 215803)

Sign In for Pricing
View Details
SNX3P1X Protein Vector (Human) (pPB-C-His)
PV132622 500 ng

SNX3P1X Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Padi3 ORF Vector (Rat) (pORF)
35927016 1.0 µg DNA

Padi3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CTP 100mM Sodium Solution
CTP001-100 100 mL

CTP 100mM Sodium Solution

Sign In for Pricing
View Details