Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC2A3 Peptide - middle region

SLC2A3 Peptide - middle region

Product Specifications

Product Name Alternative

GLUT3

UniProt

Q8TDB8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC2A3 Rabbit Polyclonal Antibody (orb588170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_008862

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIDEB Overexpression Lysate (Native) - (Dry Ice)
NBP2-07338 0.1 mg

CIDEB Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Guinea Pig Acyl Coenzyme A Thioesterase 11 ELISA Kit
MBS7257354-01 48 Well

Guinea Pig Acyl Coenzyme A Thioesterase 11 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Acyl Coenzyme A Thioesterase 11 ELISA Kit
MBS7257354-02 96 Well

Guinea Pig Acyl Coenzyme A Thioesterase 11 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Acyl Coenzyme A Thioesterase 11 ELISA Kit
MBS7257354-03 5x 96 Well

Guinea Pig Acyl Coenzyme A Thioesterase 11 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Acyl Coenzyme A Thioesterase 11 ELISA Kit
MBS7257354-04 10x 96 Well

Guinea Pig Acyl Coenzyme A Thioesterase 11 ELISA Kit

Sign In for Pricing
View Details
TNKS Peptide - middle region
MBS3226710-01 0.1 mg

TNKS Peptide - middle region

Sign In for Pricing
View Details