Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA5 Peptide - middle region

HSPA5 Peptide - middle region

Product Specifications

Product Name Alternative

BIP, MIF2, GRP78, HEL-S-89n

UniProt

P11021

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA5 Rabbit Polyclonal Antibody (orb589569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005338.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MFAP4 (Microfibrillar Associated Protein 4) ELISA Kit
ELK11353-01 48 Tests

Mouse MFAP4 (Microfibrillar Associated Protein 4) ELISA Kit

Sign In for Pricing
View Details
Mouse MFAP4 (Microfibrillar Associated Protein 4) ELISA Kit
ELK11353-02 96 Tests

Mouse MFAP4 (Microfibrillar Associated Protein 4) ELISA Kit

Sign In for Pricing
View Details
Mouse MFAP4 (Microfibrillar Associated Protein 4) ELISA Kit
ELK11353-03 5x 96 Tests

Mouse MFAP4 (Microfibrillar Associated Protein 4) ELISA Kit

Sign In for Pricing
View Details
OKRC01032-96W - YWHAE ELISA Kit (Human)
OKRC01032-96W 96 Well

OKRC01032-96W - YWHAE ELISA Kit (Human)

Sign In for Pricing
View Details
ARMC8 (NM_014154) Human Tagged Lenti ORF Clone
RC202341L4 10 µg

ARMC8 (NM_014154) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Methylenedioxy Pyrovalerone Metabolite 2 (Hydrochloride) discontinued
456098-01 2.5 mg

Methylenedioxy Pyrovalerone Metabolite 2 (Hydrochloride) discontinued

Sign In for Pricing
View Details