Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA5 Peptide - middle region

HSPA5 Peptide - middle region

Product Specifications

Product Name Alternative

BIP, MIF2, GRP78, HEL-S-89n

UniProt

P11021

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA5 Rabbit Polyclonal Antibody (orb589569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005338.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal EGFR Antibody (112) [Janelia Fluor 549]
NBP2-90789JF549 0.1 mL

Rabbit Monoclonal EGFR Antibody (112) [Janelia Fluor 549]

Sign In for Pricing
View Details
OSGIN1 ELISA Kit (Human) (OKDD00446)
OKDD00446 96 Well

OSGIN1 ELISA Kit (Human) (OKDD00446)

Sign In for Pricing
View Details
Pipcroside B
TN10983-01 10 mg

Pipcroside B

Sign In for Pricing
View Details
Pipcroside B
TN10983-02 50 mg

Pipcroside B

Sign In for Pricing
View Details
Tox Mouse Pre-designed siRNA Set A
HY-RS17002 1 Set

Tox Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human BRWD3 shRNA (UAS) - Lentiviral human BRWD3 shRNA (UAS) (25)
GTR15113477 1 Vial

Lentiviral human BRWD3 shRNA (UAS) - Lentiviral human BRWD3 shRNA (UAS) (25)

Sign In for Pricing
View Details