Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPZ Peptide - middle region

CPZ Peptide - middle region

Product Specifications

UniProt

Q66K79

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPZ Rabbit Polyclonal Antibody (orb589571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001014447.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Foxf1a Protein Vector (Mouse) (pPM-C-HA)
PV180068 500 ng

Foxf1a Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit sIL-6R ELISA Kit
ERTS0267 96 Tests

Rabbit sIL-6R ELISA Kit

Sign In for Pricing
View Details
SAT1 Antibody
18-675 100 µL

SAT1 Antibody

Sign In for Pricing
View Details
C2orf76 CRISPRa sgRNA lentivector (set of three targets)(Human)
14434121 3x 1.0µg DNA

C2orf76 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Replication Protein A 30 kDa Subunit (RPA4) Antibody
abx121213-01 30 µL

Replication Protein A 30 kDa Subunit (RPA4) Antibody

Sign In for Pricing
View Details
Replication Protein A 30 kDa Subunit (RPA4) Antibody
abx121213-02 100 µL

Replication Protein A 30 kDa Subunit (RPA4) Antibody

Sign In for Pricing
View Details