Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPZ Peptide - middle region

CPZ Peptide - middle region

Product Specifications

UniProt

Q66K79

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPZ Rabbit Polyclonal Antibody (orb589571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001014447.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human p73 alpha/beta IgG # 1, aff pure
P73A11-A 100 µg

Anti-Human p73 alpha/beta IgG # 1, aff pure

Sign In for Pricing
View Details
Proteasome 20S beta 7/PSMB7 Rabbit Polyclonal Antibody
orb1145803 100 µg

Proteasome 20S beta 7/PSMB7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNAH8 shRNA Plasmid (m)
sc-143082-SH 20 µg

DNAH8 shRNA Plasmid (m)

Sign In for Pricing
View Details
Recombinant Mouse MASP1 Protein, N-His
bs-106563P-01 20 µg

Recombinant Mouse MASP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse MASP1 Protein, N-His
bs-106563P-02 50 µg

Recombinant Mouse MASP1 Protein, N-His

Sign In for Pricing
View Details
PIGM polyclonal antibody
orb1719360-01 50 µL

PIGM polyclonal antibody

Sign In for Pricing
View Details