Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCCC1 Peptide - middle region

MCCC1 Peptide - middle region

Product Specifications

Product Name Alternative

MCCA, MCC-B

UniProt

Q96RQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCCC1 Rabbit Polyclonal Antibody (orb589572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001280202.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGRRLNISYTRNMTLKDGKNNVAIAVTYNHDGSYSMQIEDKTFQVLGNLY

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD55/DAF Affinity Purified Polyclonal Ab
AF5376 100 µg

Mouse CD55/DAF Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
IL9R Protein Vector (Rat) (pPB-C-His)
PV274606 500 ng

IL9R Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
CdcA7 Lentiviral Activation Particles (h)
sc-410181-LAC 200 µL

CdcA7 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Cish sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4490106 1.0 µg DNA

Cish sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
TP53INP1 Antibody
E19-8731-2 100 µg -100 µL

TP53INP1 Antibody

Sign In for Pricing
View Details
Kidney Injury Molecule 1 (KIM-1)
E35K5956 100 µg

Kidney Injury Molecule 1 (KIM-1)

Sign In for Pricing
View Details