Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCCC1 Peptide - middle region

MCCC1 Peptide - middle region

Product Specifications

Product Name Alternative

MCCA, MCC-B

UniProt

Q96RQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCCC1 Rabbit Polyclonal Antibody (orb589572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001280202.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGRRLNISYTRNMTLKDGKNNVAIAVTYNHDGSYSMQIEDKTFQVLGNLY

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Beta-defensin 4, DEFB4 ELISA Kit
MBS9305496-01 48 Well

Rat Beta-defensin 4, DEFB4 ELISA Kit

Sign In for Pricing
View Details
Rat Beta-defensin 4, DEFB4 ELISA Kit
MBS9305496-02 96 Well

Rat Beta-defensin 4, DEFB4 ELISA Kit

Sign In for Pricing
View Details
Rat Beta-defensin 4, DEFB4 ELISA Kit
MBS9305496-03 5x 96 Well

Rat Beta-defensin 4, DEFB4 ELISA Kit

Sign In for Pricing
View Details
Rat Beta-defensin 4, DEFB4 ELISA Kit
MBS9305496-04 10x 96 Well

Rat Beta-defensin 4, DEFB4 ELISA Kit

Sign In for Pricing
View Details
SAP30 siRNA (Human)
CRH5817-01 15 nmol

SAP30 siRNA (Human)

Sign In for Pricing
View Details
SAP30 siRNA (Human)
CRH5817-02 30 nmol

SAP30 siRNA (Human)

Sign In for Pricing
View Details