Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFC Peptide - middle region

BPIFC Peptide - middle region

Product Specifications

Product Name Alternative

BPIL2

UniProt

Q8NFQ6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BPIFC Rabbit Polyclonal Antibody (orb589576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_777592.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CYAQLSHAHVSFSGELSVLYNSFAEPMEKPILKNLNEMLCPIIASEVKAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM213 Antibody
MBS7006759-01 0.05 mg

TMEM213 Antibody

Sign In for Pricing
View Details
TMEM213 Antibody
MBS7006759-02 0.1 mg

TMEM213 Antibody

Sign In for Pricing
View Details
TMEM213 Antibody
MBS7006759-03 5x 0.1 mg

TMEM213 Antibody

Sign In for Pricing
View Details
Anti-Siglec-15/CD33L3 Antibody (Medimmune patent anti-Siglec-15)
F1810-50 50 mg

Anti-Siglec-15/CD33L3 Antibody (Medimmune patent anti-Siglec-15)

Sign In for Pricing
View Details
OLIG1 Protein Vector (Rat) (pPM-C-His)
PV286865 500 ng

OLIG1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
A2ML1 Blocking Peptide
MBS9632075-01 1 mg

A2ML1 Blocking Peptide

Sign In for Pricing
View Details