Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFC Peptide - middle region

BPIFC Peptide - middle region

Product Specifications

Product Name Alternative

BPIL2

UniProt

Q8NFQ6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BPIFC Rabbit Polyclonal Antibody (orb589576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_777592.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CYAQLSHAHVSFSGELSVLYNSFAEPMEKPILKNLNEMLCPIIASEVKAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 8 Receptor beta ELISA Kit
MBS3803742-01 48 Well

Human Interleukin 8 Receptor beta ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 8 Receptor beta ELISA Kit
MBS3803742-02 96 Well

Human Interleukin 8 Receptor beta ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 8 Receptor beta ELISA Kit
MBS3803742-03 5x 96 Well

Human Interleukin 8 Receptor beta ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 8 Receptor beta ELISA Kit
MBS3803742-04 10x 96 Well

Human Interleukin 8 Receptor beta ELISA Kit

Sign In for Pricing
View Details
C10orf4
E8ER1904-45 100 µL

C10orf4

Sign In for Pricing
View Details
Iron
MA-0103 100 Well

Iron

Sign In for Pricing
View Details