Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST3GAL6 Peptide - middle region

ST3GAL6 Peptide - middle region

Product Specifications

Product Name Alternative

SIAT10, ST3GALVI

UniProt

Q9Y274

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ST3GAL6 Rabbit Polyclonal Antibody (orb589578) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001258074.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fshb (NM_008045) Mouse Tagged ORF Clone
MG200723 10 µg

Fshb (NM_008045) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
2X ViRed OneStep Taq ReverseTrans PCR Master Mix, 100apps
RTMM02 100 Applications

2X ViRed OneStep Taq ReverseTrans PCR Master Mix, 100apps

Sign In for Pricing
View Details
PSMA3 (NM_002788) Human Over-expression Lysate
LY419116 100 µg

PSMA3 (NM_002788) Human Over-expression Lysate

Sign In for Pricing
View Details
Automatic Capillary Viscometer Washer BPTL-108
BPTL-108 1 Unit

Automatic Capillary Viscometer Washer BPTL-108

Sign In for Pricing
View Details
3-Descyano Fludioxonil 3-Carboxylic Acid
TRC-D289771-500MG 500 mg

3-Descyano Fludioxonil 3-Carboxylic Acid

Sign In for Pricing
View Details
Vamp3 Rabbit Polyclonal Antibody
AP54837SU-N 200 µL

Vamp3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details