Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NQO2 Peptide - N-terminal region

NQO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

QR2, DHQV, DIA6, NMOR2

UniProt

P16083

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NQO2 Rabbit Polyclonal Antibody (orb589734) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000895.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)
PDMM100198-01 20 µg

Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)
PDMM100198-02 100 µg

Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)
PDMM100198-03 500 µg

Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)
PDMM100198-04 1 mg

Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)

Sign In for Pricing
View Details
N-Acetyl-DL-leucine
TRC-N297790-5G 5 g

N-Acetyl-DL-leucine

Sign In for Pricing
View Details
DDX42 (NM_203499) Human Over-expression Lysate
LC404249 20 µg

DDX42 (NM_203499) Human Over-expression Lysate

Sign In for Pricing
View Details