Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDIL3 Peptide - C-terminal region

EDIL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DEL1

UniProt

O43854

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EDIL3 Rabbit Polyclonal Antibody (orb589849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001265571.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Salmonella species (A,B,C,D & E Groups) (AP)
MBS6126499-01 0.1 mL

Salmonella species (A,B,C,D & E Groups) (AP)

Sign In for Pricing
View Details
Salmonella species (A,B,C,D & E Groups) (AP)
MBS6126499-02 5x 0.1 mL

Salmonella species (A,B,C,D & E Groups) (AP)

Sign In for Pricing
View Details
EIPA hydrochloride
E5822-25mg 25 mg

EIPA hydrochloride

Sign In for Pricing
View Details
Ultra pure water (Dual-wavelength ultraviolet lamp, removal OM Type, 30L/h, Heal Force)
E5037 1 Unit

Ultra pure water (Dual-wavelength ultraviolet lamp, removal OM Type, 30L/h, Heal Force)

Sign In for Pricing
View Details
Human Interleukin 18 Binding Protein,IL18BP ELISA KIT
JOT-EK2765Hu-01 96 Well

Human Interleukin 18 Binding Protein,IL18BP ELISA KIT

Sign In for Pricing
View Details
Human Interleukin 18 Binding Protein,IL18BP ELISA KIT
JOT-EK2765Hu-02 48 Well

Human Interleukin 18 Binding Protein,IL18BP ELISA KIT

Sign In for Pricing
View Details