Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDIL3 Peptide - C-terminal region

EDIL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DEL1

UniProt

O43854

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EDIL3 Rabbit Polyclonal Antibody (orb589849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001265571.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lemborexant Metabolite M10
CS-O-64208 1 Each

Lemborexant Metabolite M10

Sign In for Pricing
View Details
DEM1, ID (DEM1, C1orf176, Probable exonuclease V, Defects in morphology protein 1 homolog) (MaxLight 405)
MBS6291678-01 0.1 mL

DEM1, ID (DEM1, C1orf176, Probable exonuclease V, Defects in morphology protein 1 homolog) (MaxLight 405)

Sign In for Pricing
View Details
DEM1, ID (DEM1, C1orf176, Probable exonuclease V, Defects in morphology protein 1 homolog) (MaxLight 405)
MBS6291678-02 5x 0.1 mL

DEM1, ID (DEM1, C1orf176, Probable exonuclease V, Defects in morphology protein 1 homolog) (MaxLight 405)

Sign In for Pricing
View Details
Anti-HLTF Antibody Picoband® Fluoro550 Conjugated
PB10070-Fluoro550 100 µg/Vial

Anti-HLTF Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Conjugated DDX17 Rabbit mAb
C56642 100 µL

Conjugated DDX17 Rabbit mAb

Sign In for Pricing
View Details
RAPGEF1 Antibody
47609 100 µL

RAPGEF1 Antibody

Sign In for Pricing
View Details