Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZW10 Peptide - C-terminal region

ZW10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HZW10, KNTC1AP

UniProt

O43264

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZW10 Rabbit Polyclonal Antibody (orb589851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004715.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKKYQEEVPVYVPKWMPFKELMMMLQASLQEIGDRWADGKGPLAAAFSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (IAP/964), 1mg/mL
BNUM0964-50 1x 50 µL

CD47 (IAP/964), 1mg/mL

Sign In for Pricing
View Details
1-Propan-1,1,2,2,3,3,3-d7-ol
TRC-P757403-50MG 50 mg

1-Propan-1,1,2,2,3,3,3-d7-ol

Sign In for Pricing
View Details
HLCS (NM_000411) Human Over-expression Lysate
LY400145 100 µg

HLCS (NM_000411) Human Over-expression Lysate

Sign In for Pricing
View Details
Caspase-3 Antibody
KC-4319-01 50 μL

Caspase-3 Antibody

Sign In for Pricing
View Details
Caspase-3 Antibody
KC-4319-02 100 µL

Caspase-3 Antibody

Sign In for Pricing
View Details
Caspase-3 Antibody
KC-4319-03 1 mL

Caspase-3 Antibody

Sign In for Pricing
View Details