Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZW10 Peptide - C-terminal region

ZW10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HZW10, KNTC1AP

UniProt

O43264

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZW10 Rabbit Polyclonal Antibody (orb589851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004715.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKKYQEEVPVYVPKWMPFKELMMMLQASLQEIGDRWADGKGPLAAAFSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMD3 Rabbit Polyclonal Antibody
TA364996 100 µL

SAMD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Propoxyandrosta-3,5-dien-17-hydroxy
TRC-P707260-50MG 50 mg

3-Propoxyandrosta-3,5-dien-17-hydroxy

Sign In for Pricing
View Details
NCK2 Antibody
8C0276-AAT 50 µg

NCK2 Antibody

Sign In for Pricing
View Details
MMP14 (N-term) Rabbit Polyclonal Antibody
AP13171PU-N 400 µL

MMP14 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,6-Difluoro-3-formylbenzoic Acid
TRC-D457383-10MG 10 mg

2,6-Difluoro-3-formylbenzoic Acid

Sign In for Pricing
View Details
Colloidal Gold Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-,  15nm
GP-1701-15 1 mL

Colloidal Gold Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-, 15nm

Sign In for Pricing
View Details