CD248 Peptide - middle region
CD248 Peptide - middle region
Product Specifications
Product Name Alternative
TEM1, CD164L1
UniProt
Q9HCU0
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD248 Rabbit Polyclonal Antibody (orb589852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_065137.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DGISCSPAGAMGAQASQDLGDELLDDGEDEEDEDEAWKAFNGGWTEMPGI
More Discoveries
Explore Other Products
Browse additional items from our catalog
367890 10 mg
Transferrin (Apotransferrin, PRO1557, beta 1 metal binding globulin, Siderophilin, Serotransferrin precursor, PRO1400, PRO2086, TF)
Sign In for Pricing
View Details RC219618L3V 200 µL
C21orf91 (NM_001100421) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
VAng-Yyj2921-1mgEcoli 1 mg (E. coli)
Recombinant Mycobacterium Bovis alr Protein (aa 1-386)
Sign In for Pricing
View Details