Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD248 Peptide - middle region

CD248 Peptide - middle region

Product Specifications

Product Name Alternative

TEM1, CD164L1

UniProt

Q9HCU0

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD248 Rabbit Polyclonal Antibody (orb589852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065137.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGISCSPAGAMGAQASQDLGDELLDDGEDEEDEDEAWKAFNGGWTEMPGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Breast
CB641341 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
WDR41 (WD Repeat-containing Protein 41, MSTP048) (MaxLight 405)
MBS6193428-01 0.1 mL

WDR41 (WD Repeat-containing Protein 41, MSTP048) (MaxLight 405)

Sign In for Pricing
View Details
WDR41 (WD Repeat-containing Protein 41, MSTP048) (MaxLight 405)
MBS6193428-02 5x 0.1 mL

WDR41 (WD Repeat-containing Protein 41, MSTP048) (MaxLight 405)

Sign In for Pricing
View Details
PROTAC BET Degrader-14
orb3177127-01 50 mg

PROTAC BET Degrader-14

Sign In for Pricing
View Details
PROTAC BET Degrader-14
orb3177127-02 10 mg

PROTAC BET Degrader-14

Sign In for Pricing
View Details
Lyst Lentiviral Activation Particles (m2)
sc-421511-LAC-2 200 µL

Lyst Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details