Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD248 Peptide - middle region

CD248 Peptide - middle region

Product Specifications

Product Name Alternative

TEM1, CD164L1

UniProt

Q9HCU0

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD248 Rabbit Polyclonal Antibody (orb589852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065137.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGISCSPAGAMGAQASQDLGDELLDDGEDEEDEDEAWKAFNGGWTEMPGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A1 Conjugated Antibody
orb1625109 100 µL

EEF1A1 Conjugated Antibody

Sign In for Pricing
View Details
Daclatasvir Impurity 48
RM-D031248-01 10 mg

Daclatasvir Impurity 48

Sign In for Pricing
View Details
Daclatasvir Impurity 48
RM-D031248-02 25 mg

Daclatasvir Impurity 48

Sign In for Pricing
View Details
Daclatasvir Impurity 48
RM-D031248-03 50 mg

Daclatasvir Impurity 48

Sign In for Pricing
View Details
Daclatasvir Impurity 48
RM-D031248-04 100 mg

Daclatasvir Impurity 48

Sign In for Pricing
View Details
HHBrk1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-5124R-BF594 100 µL

HHBrk1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details