GSTZ1 Peptide - middle region
GSTZ1 Peptide - middle region
Product Specifications
Product Name Alternative
MAI, MAAI, GSTZ1-1
UniProt
O43708
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GSTZ1 Rabbit Polyclonal Antibody (orb589855) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001504.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI3H10]](https://cdn.genprice.uk/products/937/68dd18b9061270361e908272/imageurl/cf808184.webp)
CF808184 100 µg
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI3H10]
Sign In for Pricing
View Details 
E-UNEL-H0037-01 5x 96 Tests
Uncoated Human IgE (Immunoglobulin E) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0037-02 15x 96 Tests
Uncoated Human IgE (Immunoglobulin E) ELISA Kit
Sign In for Pricing
View Details 