Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTZ1 Peptide - middle region

GSTZ1 Peptide - middle region

Product Specifications

Product Name Alternative

MAI, MAAI, GSTZ1-1

UniProt

O43708

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTZ1 Rabbit Polyclonal Antibody (orb589855) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001504.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urine Total RNA Purification Maxi 96-Well Kit (Slurry Format)
29650 96 Preparations

Urine Total RNA Purification Maxi 96-Well Kit (Slurry Format)

Sign In for Pricing
View Details
FAM153C (NM_001079527) Human Recombinant Protein
TP312359M 100 µg

FAM153C (NM_001079527) Human Recombinant Protein

Sign In for Pricing
View Details
LRRTM1 Mouse Monoclonal Antibody [Clone ID: OTI1C9]
CF805501 100 µg

LRRTM1 Mouse Monoclonal Antibody [Clone ID: OTI1C9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Duodenum
CS700876 5x 5 µm

Tissue FFPE Sections, Duodenum

Sign In for Pricing
View Details
P53 Monoclonal Antibody
E-AB-22015-01 20 µL

P53 Monoclonal Antibody

Sign In for Pricing
View Details
P53 Monoclonal Antibody
E-AB-22015-02 60 µL

P53 Monoclonal Antibody

Sign In for Pricing
View Details