SMIM7 Peptide - middle region
SMIM7 Peptide - middle region
Product Specifications
Product Name Alternative
C19orf42
UniProt
Q9BQ49
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SMIM7 Rabbit Polyclonal Antibody (orb587121) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_077009
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
438149-01 5 mg
6-Bromo-7-methoxy-1, 1-dimethyl-3, 4-dihydronaphthalen-2 (1H) -one
Sign In for Pricing
View Details 438149-02 50 mg
6-Bromo-7-methoxy-1, 1-dimethyl-3, 4-dihydronaphthalen-2 (1H) -one
Sign In for Pricing
View Details MBS9024969-01 1 g
6-(2-Morpholinoethylamino)pyri dine-3-boronic acid pinacol ester
Sign In for Pricing
View Details MBS9024969-02 5x 1 g
6-(2-Morpholinoethylamino)pyri dine-3-boronic acid pinacol ester
Sign In for Pricing
View Details