SMIM7 Peptide - middle region
SMIM7 Peptide - middle region
Product Specifications
Product Name Alternative
C19orf42
UniProt
Q9BQ49
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SMIM7 Rabbit Polyclonal Antibody (orb587121) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_077009
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-13482R-PE-Cy5.5 100 µL
GOLGA6 Polyclonal Antibody, PE-Cy5.5 Conjugated
Sign In for Pricing
View Details GTR10474958 96 Well
Monkey C type lectin domain family 10 member A (CLEC10A) ELISA kit
Sign In for Pricing
View Details 
