Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPN15 Peptide - middle region

CAPN15 Peptide - middle region

Product Specifications

Product Name Alternative

SOLH

UniProt

O75808

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPN15 Rabbit Polyclonal Antibody (orb55814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005623.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILDVRDVQGTRLLRLRNPWGRFSWNGSWSDEWPHWPGHLRGELMPHGSSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AXL (NM_021913) Human Recombinant Protein
TP306431M 100 µg

AXL (NM_021913) Human Recombinant Protein

Sign In for Pricing
View Details
Pyridin-2-yl-urea
TRC-P998933-250MG 250 mg

Pyridin-2-yl-urea

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS709478 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
S100A1 Human Gene Knockout Kit (CRISPR)
KN200278LP 1 Kit

S100A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant WIPI1 Antibody
RC-15805-01 50 μL

Recombinant WIPI1 Antibody

Sign In for Pricing
View Details
Recombinant WIPI1 Antibody
RC-15805-02 100 µL

Recombinant WIPI1 Antibody

Sign In for Pricing
View Details