Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPN15 Peptide - middle region

CAPN15 Peptide - middle region

Product Specifications

Product Name Alternative

SOLH

UniProt

O75808

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPN15 Rabbit Polyclonal Antibody (orb55814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005623.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILDVRDVQGTRLLRLRNPWGRFSWNGSWSDEWPHWPGHLRGELMPHGSSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin A / CD235a (GYPA/280), CF594 conjugate, 0.1mg/mL
BNC940280-100 1x 100 µL

Glycophorin A / CD235a (GYPA/280), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STX8 Antibody
KC-15329-01 50 μL

STX8 Antibody

Sign In for Pricing
View Details
STX8 Antibody
KC-15329-02 100 µL

STX8 Antibody

Sign In for Pricing
View Details
STX8 Antibody
KC-15329-03 1 mL

STX8 Antibody

Sign In for Pricing
View Details
Rat Luteinizing Hormone (LH) ELISA Kit
RD-LH-Ra-01 96 Tests

Rat Luteinizing Hormone (LH) ELISA Kit

Sign In for Pricing
View Details
Rat Luteinizing Hormone (LH) ELISA Kit
RD-LH-Ra-02 48 Tests

Rat Luteinizing Hormone (LH) ELISA Kit

Sign In for Pricing
View Details