Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP27B1 Peptide - C-terminal region

CYP27B1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

VDR, CP2B, CYP1, PDDR, VDD1, VDDR, VDDRI, CYP27B, P450c1, CYP1alpha

UniProt

O15528

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP27B1 Rabbit Polyclonal Antibody (orb589601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000776.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRDPAQFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnpo1 Mouse Gene Knockout Kit (CRISPR)
KN518027 1 Kit

Tnpo1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BTBD11 (NM_001017523) Human Over-expression Lysate
LY422738 100 µg

BTBD11 (NM_001017523) Human Over-expression Lysate

Sign In for Pricing
View Details
Bst2UI, 1000U
RE1202 1000 U

Bst2UI, 1000U

Sign In for Pricing
View Details
RED-BETA-D-GAL, 100 mg
#10012 1x 100 mg

RED-BETA-D-GAL, 100 mg

Sign In for Pricing
View Details
CENPC (NM_001812) Human Over-expression Lysate
LC419733 20 µg

CENPC (NM_001812) Human Over-expression Lysate

Sign In for Pricing
View Details
RFESD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A7]
TA505809AM 100 µL

RFESD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A7]

Sign In for Pricing
View Details