Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR3 Peptide - C-terminal region

CCR3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CKR3, CD193, CMKBR3, CC-CKR-3

UniProt

P51677

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCR3 Rabbit Polyclonal Antibody (orb589602) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001828.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Twinfilin 1 ELISA Kit
MBS062302 Inquire

Goose Twinfilin 1 ELISA Kit

Sign In for Pricing
View Details
CASP7 ORF Vector (Human) (pORF)
ORF001891 1.0 µg DNA

CASP7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
IQUB Protein Vector (Mouse) (pPM-C-HA)
25070024 500 ng

IQUB Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
3,4,5-Trichloro-6-hydroxy-2-picolinic Acid
T774190 25 mg

3,4,5-Trichloro-6-hydroxy-2-picolinic Acid

Sign In for Pricing
View Details
EAN57 CRISPR Activation Plasmid (h)
sc-415524-ACT 20 µg

EAN57 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
MAGEC1 discontinued
322943 100 µL

MAGEC1 discontinued

Sign In for Pricing
View Details