Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR3 Peptide - C-terminal region

CCR3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CKR3, CD193, CMKBR3, CC-CKR-3

UniProt

P51677

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCR3 Rabbit Polyclonal Antibody (orb589602) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001828.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Peptide Recombinant Rabbit mAb (SDT-638-43)
S0B3225-01 10 mg

C-Peptide Recombinant Rabbit mAb (SDT-638-43)

Sign In for Pricing
View Details
C-Peptide Recombinant Rabbit mAb (SDT-638-43)
S0B3225-02 0.1 mg

C-Peptide Recombinant Rabbit mAb (SDT-638-43)

Sign In for Pricing
View Details
C-Peptide Recombinant Rabbit mAb (SDT-638-43)
S0B3225-03 0.5 mg

C-Peptide Recombinant Rabbit mAb (SDT-638-43)

Sign In for Pricing
View Details
C-Peptide Recombinant Rabbit mAb (SDT-638-43)
S0B3225-04 1 mg

C-Peptide Recombinant Rabbit mAb (SDT-638-43)

Sign In for Pricing
View Details
APO B 5+1
A06608H 2x 25 mL Buffer + 1x 10 mL Ab

APO B 5+1

Sign In for Pricing
View Details
LAMP1 Rabbit Polyclonal Antibody
orb13749-01 50 μL

LAMP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details