HDAC3 Peptide - C-terminal region
HDAC3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HD3, RPD3, RPD3-2
UniProt
O15379
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HDAC3 Rabbit Polyclonal Antibody (orb589603) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003874.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKES
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP305263 20 µg
Protein phosphatase inhibitor 1 (PPP1R1A) (NM_006741) Human Recombinant Protein
Sign In for Pricing
View Details 
