Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR5 Peptide - C-terminal region

CXCR5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BLR1, CD185, MDR15

UniProt

P32302

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CXCR5 Rabbit Polyclonal Antibody (orb589604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001707.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC2 (TSC2, TSC4, Tuberin, Tuberous sclerosis 2 protein) (MaxLight 550)
MBS6210000-01 0.1 mL

TSC2 (TSC2, TSC4, Tuberin, Tuberous sclerosis 2 protein) (MaxLight 550)

Sign In for Pricing
View Details
TSC2 (TSC2, TSC4, Tuberin, Tuberous sclerosis 2 protein) (MaxLight 550)
MBS6210000-02 5x 0.1 mL

TSC2 (TSC2, TSC4, Tuberin, Tuberous sclerosis 2 protein) (MaxLight 550)

Sign In for Pricing
View Details
Anti-SLY1 Antibody
MBS8304062-01 0.03 mL

Anti-SLY1 Antibody

Sign In for Pricing
View Details
Anti-SLY1 Antibody
MBS8304062-02 0.05 mL

Anti-SLY1 Antibody

Sign In for Pricing
View Details
Anti-SLY1 Antibody
MBS8304062-03 0.1 mL

Anti-SLY1 Antibody

Sign In for Pricing
View Details
Anti-SLY1 Antibody
MBS8304062-04 0.2 mL

Anti-SLY1 Antibody

Sign In for Pricing
View Details