Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR5 Peptide - C-terminal region

CXCR5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BLR1, CD185, MDR15

UniProt

P32302

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CXCR5 Rabbit Polyclonal Antibody (orb589604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001707.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Haptoglobin
MBS564186-01 96 Well

Sheep Haptoglobin

Sign In for Pricing
View Details
Sheep Haptoglobin
MBS564186-02 5x 96 Well

Sheep Haptoglobin

Sign In for Pricing
View Details
UGT2B28 (h) -PR
sc-106669-PR 10 µM - 20 µL

UGT2B28 (h) -PR

Sign In for Pricing
View Details
Emricasan
TRC-E525300-250MG 250 mg

Emricasan

Sign In for Pricing
View Details
Disposable Sack sampler 25mm dia - box of 100
SAM1055 100 / PCK

Disposable Sack sampler 25mm dia - box of 100

Sign In for Pricing
View Details
Phospho-TNIK (Ser764) Rabbit Polyclonal Antibody (AP)
orb893335 100 µL

Phospho-TNIK (Ser764) Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details