UCP3 Peptide - middle region
UCP3 Peptide - middle region
Product Specifications
Product Name Alternative
SLC25A9
UniProt
P55916
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UCP3 Rabbit Polyclonal Antibody (orb589609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003347.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2369201 100 µL
Histone H3 (mono methyl K79) Mouse Monoclonal Antibody (BF555)
Sign In for Pricing
View Details 
32950154 3x 1.0 µg DNA
Olfr168 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details