Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCP3 Peptide - middle region

UCP3 Peptide - middle region

Product Specifications

Product Name Alternative

SLC25A9

UniProt

P55916

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCP3 Rabbit Polyclonal Antibody (orb589609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003347.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF691 shRNA Plasmid (m)
sc-155780-SH 20 µg

ZNF691 shRNA Plasmid (m)

Sign In for Pricing
View Details
Afloqualone
BA6662-5.1 1 mL (10 mM in DMSO)

Afloqualone

Sign In for Pricing
View Details
HSP70 Polyclonal Antibody, Cy7 Conjugated
bs-0244R-Cy7 100 µL

HSP70 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
C11orf82 Protein Vector (Human) (pPB-His-MBP)
PV328458 500 ng

C11orf82 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Recombinant Human CNTF Protein, His, E.coli-1mg
QP8530-ec-1mg 1mg

Recombinant Human CNTF Protein, His, E.coli-1mg

Sign In for Pricing
View Details
Anti-RANK/TNFRSF11A Antibody Picoband® (Biotine Conjugate)
A01064-2-Biotin 100 µg/Vial

Anti-RANK/TNFRSF11A Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details