Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPHK1 Peptide - C-terminal region

SPHK1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SPHK

UniProt

Q9NYA1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPHK1 Rabbit Polyclonal Antibody (orb589614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001136073.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKGVFAVDGELMVSEAVQGQVHPNYFWMVSGCVEPPPSWKPQQMPPPEEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182UM-01 25 µg

Elab Fluor® 647 Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182UM-02 100 µg

Elab Fluor® 647 Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3042), CF640R conjugate, 0.1mg/mL
BNC403042-100 1x 100 µL

Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3042), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Shroom4 Mouse Gene Knockout Kit (CRISPR)
KN515768 1 Kit

Shroom4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GDAP1L1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G5]
TA503153BM 100 µL

GDAP1L1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G5]

Sign In for Pricing
View Details
NF-kappaB p105/p50 Mouse Monoclonal Antibody [A2-7]
M1505-8 100 µL

NF-kappaB p105/p50 Mouse Monoclonal Antibody [A2-7]

Sign In for Pricing
View Details